A Chain:
GYSEKCCLTGCTKEELSIACLPYIDF
B Chain:
RELSDISSARKLCGRYLVKEIEKLCGHANWSQF
Disulfide bonds: CysA6-CysA11, CysA7-CysB13, CysA20-CysB25
| Molecular Weight: | 6719.2 |
| Purity (HPLC): | ≥ 98% (chromatogram) |
| Validation: | Exhibits correct molecular weight. |
| Solubility: | Soluble in water |
| Storage: | Up to 12 months in lyophilized form at 2-8°C. |
| Appearance: | White powder |
| Contents: | Each vial contains 1.0 mg of net peptide. |
| MSDS: | I6-msds |
| Catalog # | Quantity | Pack Size | Price (Euro) |
| I6.00001 | 0.1mg | 0.1mg | 100 |
| I6.0001 | 1mg | 1mg | 720 |
| I6.001 | 10mg | 1mg | 5400 |
| I6.01 | 100mg | 10mg | on request |
| I6.1 | 1000mg | 100mg | on request |